This server is a protein structure prediction tool that processes prediction requests from users and capable of returning various scores for protein sequences.
To install the environment, follow these steps:
git clone https://github.com/Oaklight/protein-score-server.git
cd protein-score-server
conda env create -f environment.yaml
conda activate esm
pip install -r requirements.txt
Configuration File:
server.yaml.sample to server.yaml :cp server.yaml.sample server.yaml
server.yaml with your settings.The server uses the server.yaml file for configuration. Currently configurable items include:
api_key: API key for Hugging Face Hub login.history_path: History result storage path.intermediate_pdb_path: Intermediate PDB file storage path.model: Model configuration
name: model name, esmfold or protenix (bytedances' alphafold3 implementation)replica: GPU device and replications mapping, should be in <device>: <num_replica> format. For esmfold case, use _: <num_replica> instead.task_queue_size: Task queue size, default to 50.timeout: Timeout for async prediction result retrieval, default to 15 seconds.backbone_pdb:
reversed_index: path for reverse index from pdb id to pdb file pathparquet_prefix: path prefix for parquet filespdb_prefix: path prefix for pdb filesFor example, see server.yaml
After the config are set, run these commands inside the project folder:
conda activate esm
uvicorn main:app --host 0.0.0.0 --port 8000
Users can send POST requests to http://your-host:8000/predict/ to get predictions. The request body comprises of these fields: seq , name , type , seq2 .
seq: String, representing the protein sequence.name: String, representing the name of the reference protein.type: String, representing the task type, currently supports “plddt”, “tmscore”, “sc-tmscore”, “pdb”.seq2: String, representing the sequence of the reference protein. Used only for sc-tmscore task. You may choose to provide either seq2 or name{
"seq": "MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST",
"type": "plddt"
}
{
"seq": "MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST",
"name": "1a0a.A", # must provide for tasks that require a reference structure
"type": "tmscore"
}
{
"seq": "MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST",
"seq2": "MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST", # choose to provide either seq2 or name
"type": "sc-tmscore"
}
or
{
"seq": "MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST",
"name": "1a0a.A", # choose to provide either seq2 or name
"type": "sc-tmscore"
}
{
"seq": "MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST",
"type": "pdb"
}
The server will return a JSON response containing two fields: job_id and prediction .
job_id: String, representing the task ID.prediction: String, currently only indicating the prediction is in processing.{
"job_id": "0a98a981748c4b7eacfd5e0957905ced", # this is a uuid4 hex string
"prediction": ... # not very useful at this moment
}
Users can send GET requests to http://your-host:8000/result/{job_id} to get prediction results. The header of the request should contain Content-Type: application/json .
The server will return a JSON response containing two fields: job_id and prediction .
{
"job_id": "0a98a981748c4b7eacfd5e0957905ced", # this is a uuid4 hex string
"prediction": 0.983124
}
When querying for results, use the following guidelines based on the status code:
test.py.To stop the server, use Ctrl+C in the terminal where the server is running.
This server is licensed under the Apache License 2.0.